MCP HubMCP Hub
SKILL·C4627F

glycoengineering

K-Dense-AI
업데이트됨 3 months ago
11 조회
44,583
4,040
44,583
GitHub에서 보기
디자인design

정보

이 스킬은 단백질 서열에서 N-글리코실화 부위를 스캔하고 O-글리코실화 핫스팟을 예측하여 단백질 글리코실화를 분석 및 설계합니다. NetOGlyc와 GlycoWorkbench 같은 정제된 도구들을 실용적인 작업에 활용할 수 있도록 제공합니다. 당단백질 공학, 치료용 항체 최적화, 백신 설계에 사용하세요.

빠른 설치

Claude Code

추천
기본
npx skills add K-Dense-AI/claude-scientific-skills -a claude-code
플러그인 명령대체
/plugin add https://github.com/K-Dense-AI/claude-scientific-skills
Git 클론대체
git clone https://github.com/K-Dense-AI/claude-scientific-skills.git ~/.claude/skills/glycoengineering

Claude Code에서 이 명령을 복사하여 붙여넣어 스킬을 설치하세요

문서

Glycoengineering

Overview

Glycosylation is the most common and complex post-translational modification (PTM) of proteins, affecting over 50% of all human proteins. Glycans regulate protein folding, stability, immune recognition, receptor interactions, and pharmacokinetics of therapeutic proteins. Glycoengineering involves rational modification of glycosylation patterns for improved therapeutic efficacy, stability, or immune evasion.

Two major glycosylation types:

  • N-glycosylation: Attached to asparagine (N) in the sequon N-X-[S/T] where X ≠ Proline; occurs in the ER/Golgi
  • O-glycosylation: Attached to serine (S) or threonine (T); no strict consensus motif; primarily GalNAc initiation

When to Use This Skill

Use this skill when:

  • Antibody engineering: Optimize Fc glycosylation for enhanced ADCC, CDC, or reduced immunogenicity
  • Therapeutic protein design: Identify glycosylation sites that affect half-life, stability, or immunogenicity
  • Vaccine antigen design: Engineer glycan shields to focus immune responses on conserved epitopes
  • Biosimilar characterization: Compare glycan patterns between reference and biosimilar
  • Drug target analysis: Does glycosylation affect target engagement for a receptor?
  • Protein stability: N-glycans often stabilize proteins; identify sites for stabilizing mutations

N-Glycosylation Sequon Analysis

Scanning for N-Glycosylation Sites

N-glycosylation occurs at the sequon N-X-[S/T] where X ≠ Proline.

import re
from typing import List, Tuple

def find_n_glycosylation_sequons(sequence: str) -> List[dict]:
    """
    Scan a protein sequence for canonical N-linked glycosylation sequons.
    Motif: N-X-[S/T], where X ≠ Proline.

    Args:
        sequence: Single-letter amino acid sequence

    Returns:
        List of dicts with position (1-based), motif, and context
    """
    seq = sequence.upper()
    results = []
    i = 0
    while i <= len(seq) - 3:
        triplet = seq[i:i+3]
        if triplet[0] == 'N' and triplet[1] != 'P' and triplet[2] in {'S', 'T'}:
            context = seq[max(0, i-3):i+6]  # ±3 residue context
            results.append({
                'position': i + 1,   # 1-based
                'motif': triplet,
                'context': context,
                'sequon_type': 'NXS' if triplet[2] == 'S' else 'NXT'
            })
            i += 3
        else:
            i += 1
    return results

def summarize_glycosylation_sites(sequence: str, protein_name: str = "") -> str:
    """Generate a research log summary of N-glycosylation sites."""
    sequons = find_n_glycosylation_sequons(sequence)

    lines = [f"# N-Glycosylation Sequon Analysis: {protein_name or 'Protein'}"]
    lines.append(f"Sequence length: {len(sequence)}")
    lines.append(f"Total N-glycosylation sequons: {len(sequons)}")

    if sequons:
        lines.append(f"\nN-X-S sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXS')}")
        lines.append(f"N-X-T sites: {sum(1 for s in sequons if s['sequon_type'] == 'NXT')}")
        lines.append(f"\nSite details:")
        for s in sequons:
            lines.append(f"  Position {s['position']}: {s['motif']} (context: ...{s['context']}...)")
    else:
        lines.append("No canonical N-glycosylation sequons detected.")

    return "\n".join(lines)

# Example: IgG1 Fc region
fc_sequence = "APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK"
print(summarize_glycosylation_sites(fc_sequence, "IgG1 Fc"))

Mutating N-Glycosylation Sites

def eliminate_glycosite(sequence: str, position: int, replacement: str = "Q") -> str:
    """
    Eliminate an N-glycosylation site by substituting Asn → Gln (conservative).

    Args:
        sequence: Protein sequence
        position: 1-based position of the Asn to mutate
        replacement: Amino acid to substitute (default Q = Gln; similar size, not glycosylated)

    Returns:
        Mutated sequence
    """
    seq = list(sequence.upper())
    idx = position - 1
    assert seq[idx] == 'N', f"Position {position} is '{seq[idx]}', not 'N'"
    seq[idx] = replacement.upper()
    return ''.join(seq)

def add_glycosite(sequence: str, position: int, flanking_context: str = "S") -> str:
    """
    Introduce an N-glycosylation site by mutating a residue to Asn,
    and ensuring X ≠ Pro and +2 = S/T.

    Args:
        position: 1-based position to introduce Asn
        flanking_context: 'S' or 'T' at position+2 (if modification needed)
    """
    seq = list(sequence.upper())
    idx = position - 1

    # Mutate to Asn
    seq[idx] = 'N'

    # Ensure X+1 != Pro (mutate to Ala if needed)
    if idx + 1 < len(seq) and seq[idx + 1] == 'P':
        seq[idx + 1] = 'A'

    # Ensure X+2 = S or T
    if idx + 2 < len(seq) and seq[idx + 2] not in ('S', 'T'):
        seq[idx + 2] = flanking_context

    return ''.join(seq)

O-Glycosylation Analysis

Heuristic O-Glycosylation Hotspot Prediction

def predict_o_glycosylation_hotspots(
    sequence: str,
    window: int = 7,
    min_st_fraction: float = 0.4,
    disallow_proline_next: bool = True
) -> List[dict]:
    """
    Heuristic O-glycosylation hotspot scoring based on local S/T density.
    Not a substitute for NetOGlyc; use as fast baseline.

    Rules:
    - O-GalNAc glycosylation clusters on Ser/Thr-rich segments
    - Flag Ser/Thr residues in windows enriched for S/T
    - Avoid S/T immediately followed by Pro (TP/SP motifs inhibit GalNAc-T)

    Args:
        window: Odd window size for local S/T density
        min_st_fraction: Minimum fraction of S/T in window to flag site
    """
    if window % 2 == 0:
        window = 7
    seq = sequence.upper()
    half = window // 2
    candidates = []

    for i, aa in enumerate(seq):
        if aa not in ('S', 'T'):
            continue
        if disallow_proline_next and i + 1 < len(seq) and seq[i+1] == 'P':
            continue

        start = max(0, i - half)
        end = min(len(seq), i + half + 1)
        segment = seq[start:end]
        st_count = sum(1 for c in segment if c in ('S', 'T'))
        frac = st_count / len(segment)

        if frac >= min_st_fraction:
            candidates.append({
                'position': i + 1,
                'residue': aa,
                'st_fraction': round(frac, 3),
                'window': f"{start+1}-{end}",
                'segment': segment
            })

    return candidates

External Glycoengineering Tools

1. NetOGlyc 4.0 (O-glycosylation prediction)

Web service for high-accuracy O-GalNAc site prediction:

import requests

def submit_netoglycv4(fasta_sequence: str) -> str:
    """
    Submit sequence to NetOGlyc 4.0 web service.
    Returns the job URL for result retrieval.

    Note: This uses the DTU Health Tech web service. Results take ~1-5 min.
    """
    url = "https://services.healthtech.dtu.dk/cgi-bin/webface2.cgi"
    # NetOGlyc submission (parameters may vary with web service version)
    # Recommend using the web interface directly for most use cases
    print("Submit sequence at: https://services.healthtech.dtu.dk/services/NetOGlyc-4.0/")
    return url

# Also: NetNGlyc for N-glycosylation prediction
# URL: https://services.healthtech.dtu.dk/services/NetNGlyc-1.0/

2. GlycoShield-MD (Glycan Shielding Analysis)

GlycoShield-MD analyzes how glycans shield protein surfaces during MD simulations:

# Installation
pip install glycoshield

# Basic usage: analyze glycan shielding from glycosylated protein MD trajectory
glycoshield \
    --topology glycoprotein.pdb \
    --trajectory glycoprotein.xtc \
    --glycan_resnames BGLCNA FUC \
    --output shielding_analysis/

3. GlycoWorkbench (Glycan Structure Drawing/Analysis)

4. GlyConnect (Glycan-Protein Database)

  • URL: https://glyconnect.expasy.org/
  • Use: Find experimentally verified glycoproteins and glycosylation sites
  • Query: By protein (UniProt ID), glycan structure, or tissue
import requests

def query_glyconnect(uniprot_id: str) -> dict:
    """Query GlyConnect for glycosylation data for a protein."""
    url = f"https://glyconnect.expasy.org/api/proteins/uniprot/{uniprot_id}"
    response = requests.get(url, headers={"Accept": "application/json"})
    if response.status_code == 200:
        return response.json()
    return {}

# Example: query EGFR glycosylation
egfr_glyco = query_glyconnect("P00533")

5. UniCarbKB (Glycan Structure Database)

  • URL: https://unicarbkb.org/
  • Use: Browse glycan structures, search by mass or composition
  • Format: GlycoCT or IUPAC notation

Key Glycoengineering Strategies

For Therapeutic Antibodies

GoalStrategyNotes
Enhance ADCCDefucosylation at Fc Asn297Afucosylated IgG1 has ~50× better FcγRIIIa binding
Reduce immunogenicityRemove non-human glycansEliminate α-Gal, NGNA epitopes
Improve PK half-lifeSialylationSialylated glycans extend half-life
Reduce inflammationHypersialylationIVIG anti-inflammatory mechanism
Create glycan shieldAdd N-glycosites to surfaceMasks vulnerable epitopes (vaccine design)

Common Mutations Used

MutationEffect
N297A/Q (IgG1)Removes Fc glycosylation (aglycosyl)
N297D (IgG1)Removes Fc glycosylation
S298A/E333A/K334AIncreases FcγRIIIa binding
F243L (IgG1)Increases defucosylation
T299ARemoves Fc glycosylation

Glycan Notation

IUPAC Condensed Notation (Monosaccharide abbreviations)

SymbolFull NameType
GlcGlucoseHexose
GlcNAcN-AcetylglucosamineHexNAc
ManMannoseHexose
GalGalactoseHexose
FucFucoseDeoxyhexose
Neu5AcN-Acetylneuraminic acid (Sialic acid)Sialic acid
GalNAcN-AcetylgalactosamineHexNAc

Complex N-Glycan Structure

Typical complex biantennary N-glycan:
Neu5Ac-Gal-GlcNAc-Man\
                       Man-GlcNAc-GlcNAc-[Asn]
Neu5Ac-Gal-GlcNAc-Man/
(±Core Fuc at innermost GlcNAc)

Best Practices

  • Start with NetNGlyc/NetOGlyc for computational prediction before experimental validation
  • Verify with mass spectrometry: Glycoproteomics (Byonic, Mascot) for site-specific glycan profiling
  • Consider site context: Not all predicted sequons are actually glycosylated (accessibility, cell type, protein conformation)
  • For antibodies: Fc N297 glycan is critical — always characterize this site first
  • Use GlyConnect to check if your protein of interest has experimentally verified glycosylation data

Additional Resources

GitHub 저장소

K-Dense-AI/claude-scientific-skills
경로: skills/glycoengineering
0
agent-skillsai-scientistbioinformaticschemoinformaticsclaudeclaude-skills
FAQ

자주 묻는 질문

glycoengineering Skill이란 무엇인가요?

glycoengineering은(는) K-Dense-AI이(가) 만든 Claude Skill입니다. Skill은 Claude가 필요할 때 불러오는 지침과 리소스를 묶어 추가 프롬프트 없이 glycoengineering 관련 작업을 수행할 수 있게 합니다.

glycoengineering은(는) 어떻게 설치하나요?

이 페이지의 설치 명령을 사용하세요. glycoengineering을(를) Claude Code 플러그인으로 추가하거나 저장소를 skills 디렉터리에 복제한 다음 Claude를 다시 시작해 Skill을 불러옵니다.

glycoengineering은(는) 어떤 카테고리에 속하나요?

glycoengineering은(는) 디자인 카테고리에 속합니다.

glycoengineering은(는) 무료로 사용할 수 있나요?

네. glycoengineering은(는) AIMCP에 등록되어 있으며 무료로 설치할 수 있습니다.

연관 스킬

executing-plans
디자인

executing-plans 스킬은 검토 체크포인트가 포함된 통제된 배치로 실행할 완전한 구현 계획이 있을 때 사용합니다. 이 스킬은 계획을 불러와 비판적으로 검토한 후, 소규모 배치(기본값 3개 작업)로 작업을 실행하면서 각 배치 사이에 진행 상황을 아키텍트 검토를 위해 보고합니다. 이를 통해 내재된 품질 관리 체크포인트를 갖춘 체계적인 구현이 보장됩니다.

스킬 보기
requesting-code-review
디자인

이 스킬은 코드 변경 사항을 요구 사항에 따라 분석하기 위해 코드 리뷰어 하위 에이전트를 호출합니다. 작업 완료 후, 주요 기능 구현 후, 또는 메인 브랜치에 병합하기 전에 사용해야 합니다. 이 리뷰는 현재 구현체와 원래 계획을 비교하여 문제를 조기에 발견하는 데 도움이 됩니다.

스킬 보기
connect-mcp-server
디자인

이 스킬은 개발자들이 HTTP, stdio 또는 SSE 전송 방식을 통해 MCP 서버를 Claude Code에 연결하는 포괄적인 가이드를 제공합니다. GitHub, Notion 및 사용자 정의 API와 같은 외부 서비스를 통합하기 위한 설치, 구성, 인증 및 보안을 다룹니다. MCP 통합 설정, 외부 도구 구성 또는 Claude의 모델 컨텍스트 프로토콜 작업 시 활용하세요.

스킬 보기
web-cli-teleport
디자인

이 스킬은 작업 분석을 기반으로 개발자가 Claude Code 웹 인터페이스와 CLI 인터페이스 중 선택할 수 있도록 돕고, 두 환경 간 원활한 세션 텔레포트를 가능하게 합니다. 웹, CLI 또는 모바일 환경 전환 시 세션 상태와 컨텍스트를 관리하여 워크플로를 최적화합니다. 다양한 단계에서 서로 다른 도구가 필요한 복잡한 프로젝트에 사용하세요.

스킬 보기